PRL cells |
PRLHR |
Penaeidin-3i |
||
(approved gene symbol) [prolactin releasing hormone]. Abbr. also: PRH; Also: PrRP [prolactin releasing peptide]. Also: prolactin releasing factor (note that this term may be used generically also for any factor causing the release of prolactin from producer cells).
PRLH has been identified by Hinuma et al (1998) as the ligand of an orphan receptor (subsequently designated PRLHR, see below). PRLH is a ligand of 31 amino acids [SRTHRHSMEIRTPDINPAWYASRGIRPVGRF]. PRLH exists in two isoforms, usually termed PrRP31 [prolactin releasing peptide 31
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |