PCLP1 |
PCM-binding peptide |
SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK |
||
[PCM-binding peptide; primary cardiomyocyte binding peptide-1]
This peptide with the sequence WLSEAGPVVTVRALRGTGSW has been identified by phage display methods (McGuire et al, 2004). The peptide shares a stretch of 12 amino acid residues (with one gap) that is identical to a portion of the mouse extracellular matrix protein tenascin-X (VTVRALRGTSW). This peptide shows preferential binding to primary cardiomyocytes over other cell types and preferentially localizes to the heart in vivo.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |