PAF |
PAFSPWGamide |
tum transplantation antigens |
||
[Phytolacca antifungal protein] PAFP-S is a highly basic antifungal peptide (AGCIKNGGRCNASAGPPYCCSSYCFQIAGQSYGVCKNR) isolated from seeds of Phytolacca americana (American pokeweed; Phytolacca decandra) (Shao et al, 1999). PAFP-S shares significant sequence similarity with antimicrobial peptides from Mirabilis jalapa (Mj-AMP). PAFP-S contains a knottin motif (Gao et al, 2001), and a hydrophobic surface essential for its interaction with fungal membrane lipids and the antifungal activity (Peng et al, 2005).
PAFP-S exhibits a broad spectrum of antifungal activity. It is inactive on Escherichia coli. The peptide has been described independently as Pa-AMP-1 [Phytolacca americana antimicrobial peptide-1
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |