Oreochromicin-3 |
orexin A |
triggering receptor expressed on monocytes 2 |
||
Oreochromicins are alpha-helical antimicrobial peptides (Oreochromicin-1 (FIHHIIGGLFSVGKHIHGLIHGH), Oreochromicin-2 (FIHHIIGGLFSAGKAIHRLIRRRRR), Oreochromicin-3) (IWDAIFHGAKHFLHRLVNPGGKDAVKDVQQKQ) isolated from tilapia (Oreochromis niloticus) (Acosta et al, 2013). These peptides are expressed constitutively in the brain, heart, head kidney, spleen and gut. The synthetic peptides display a broad-spectrum of antimicrobial activity against Gram-negative, Gram-positive bacteria, and fungi such as Staphylococcus aureus, Bacillus subtilis, Pseudomonas aeuroginosa, Escherichia coli
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |