Neuroligin-3 |
neurolysin |
HGPDSCNHDRGLCRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT |
||
The primary sequence of this protein has been determined by Denzinger et al (1999). Neurolin is a growth-associated cell surface glycoprotein from goldfish and zebrafish. E21 antigen, a cell surface glycoprotein that is recognized by a monoclonal antibody of the same name and is expressed selectively on fish retinal ganglion cell axons (Paschke et al, 1992).
The protein has been shown to be involved in axonal pathfinding in the goldfish retina. Antibodies against neurolin cause aberrant optic disk-directed growth of retinal ganglion cell axons and affect axonal fasciculation (Ott et al, 1998; Leppert et al, 1999).
Neurolin is the fish homolog of DM-GRASP. In the
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |