NRGN(55-78) |
Nrh |
SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK |
||
[Negative Regulator of Haematopoiesis] This acidic, glycosylated heparin binding protein (approximately 20 kDa) is found in the conditioned medium of the human macrophage line 2MAC. It acts as a reversible suppressor of early hematopoietic progenitor cells of the BFU-E type (see also: hematopoietic stem cells, Hematopoiesis), markedly decreasing the cycling of early progenitor cells (see also: cell cycle). The factor suppresses the cycling of [high proliferative potential colony-forming cells, HPP-CFC, in CD34(+) preparations obtained from mobilized peripheral blood
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |