Megin 1 |
Meg-Pot |
ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
||
This antimicrobial peptide, FFVLKFLLKWAGKVGLEHLACKFKNWC, has been isolated from the skin venoms of the spadefoot toad Megophrys minor (Pelobatidae, Anura, Amphibia) (Yang et al, 2016). Megin 1 shows potent antimicrobial activity against Escherichia coli, Bacillus dysenteriae, Staphylococcus aureus, Bacillus subtilis, and Candida albicans. The peptide shows strong hemolytic activity against human and rabbit erythrocytes.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |