MERGL |
meRNAs |
GLPQDCERRGGFCSHKSCPPGIGRIGLCSKEDFCCRSRWYS |
||
[myeloid and encephalic region-located transcript] This gene, which encodes a highly conserved protein in vertebrates, has been identified by Yamakawa et al (2020).
MERLOT is an important regulator for the termination of osteoclastogenesis. The expression of MERLOT is induced significantly by RANKL stimulation, and suppresses osteoclast differentiation and induces cell death by apoptosis. Knock-out mice lacking expression of MERLOT exhibit low bone mass due to increased osteoclast and bone resorption. Osteoclast precursors overexpressing MERLOT fail to differentiate into mature osteoclasts
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |