MECIF |
Meconium antigen 100 |
DCpep |
||
[melanocortin-like peptide of E. coli] This peptide with the sequence SLTKGRASYTMEFLKYDEAPSNVAQAVIEARGK is released in cultures of Escherichia coli. The sequence is identical to the C-terminus of the Escherichia coli elongation factor-G and is thought to be encoded by the fusA gene. MECO-1 qualifies as a member of a growing group of proteins referred to as moonlighting proteins because they seem to have at least two distinct and unrelated functions.
Some bioactivities of MECO-1 resemble those of mammalian alpha-melanocyte-stimulating hormone (alpha-MSH) and adrenocorticotropin (ACTH). At femtomolar
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |