Maverick |
MAX.3 antigen |
AGECVQGRCPSGMCCSQFGYCGRGPKYCGR |
||
[mitochondrial antiviral signaling protein] This protein has been described under various names. The gene has been cloned as KIAA1271, MAVS (Seth et al, 2005), IPS1 [Interferon-beta promoter stimulator protein 1] (Kawai et al, 2005), VISA [Virus-induced-signaling adapter] (Xu et al, 2005), and CARDIF [CARD adapter inducing interferon-beta] (Meylan et al, 2005).
MAVS has been shown to be critical in the IFN-beta signaling pathway and is required for both Sendai virus-triggered signaling that depends on, or is independent of, the TLR3 receptor. The signaling pathway dependent of TLR3
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |