KIAKVALKAL |
KICCPSNQARNGYSVCRIRFSKGRCMQVSGCQNSDTCPRGWVN |
chemokine (C-C motif) ligand 3 |
||
[Kidney inhibitor of apoptosis] This human protein contains a single BIR domain and RING finger motif and has been cloned from a human fetal kidney cDNA library The protein has been renamed BIRC7 [baculoviral IAP repeat-containing protein-7]. See: IAP [inhibitor of apoptosis].
The gene maps to human chromosome 20q13.3. Transcripts of various sizes are observed in placenta, lymph node, and fetal kidney but not in other normal tissues.
The protein blocks cell death by apoptosis induced by BAX
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |