IIPLPLGYFAKKT |
IK |
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
||
[interferon-inducible secretoglobin] The approved gene symbol is SCGB1D4 [secretoglobin 1D4; secretoglobin family 1D member 4].
This protein has been identified by Choi et al (2004). It shows 30 % amino acid sequence identity with uteroglobin. Its expression in lymphoblast cells is augmented by IFN-gamma treatment. IIS is expressed in virtually all tissues, and the highest level of expression is detectable in lymph nodes, tonsil, cultured lymphoblasts, and the ovary. The expression of IIS mRNA is not significantly different in resting lymphoid cells, but is elevated markedly in activated CD8(+) and CD19(+) cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |