Gallid alphaherpesvirus 2 MEQ protein |
Gallin-1 |
liver enriched antimicrobial peptide 2 |
||
Gallin (VLKYCPKIGYCSNTCSKTQIWATSHGCKMYCCLPASWKWK) (also termed Gallin-1) is an antimicrobial peptide present in egg white.
There are at least 3 forms of the gallin gene in the chicken genome in 3 separate lines of chicken. All forms are expressed in the tubular cells of the magnum region of the oviduct. The gallin peptide family contains a six cysteine motif found in all defensins, and is most closely related to avian beta-Defensins, although the cysteine spacing differs. Gallin is a member of a family of avian proteins referred to as ovodefensins. The mature gallin peptide
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |