GPR29 |
GPR35 |
ALWKDVLKKIGTVALHAGKAAFGAAADTISQGGS |
||
[G-protein-coupled receptor-30] Carmeci et al (1997) have identified GPR30 as a gene overexpressed in breast carcinoma cell lines overexpressing the estrogen receptor. Databank synonyms for this receptor are DRY12 and GPCR-Br.
This receptor is known also as CMKRL2 [chemokine receptor-like 2]. This receptor cDNA has been isolated by Owman et al (1995) from human B-cell lymphoblasts, employing PCR with degenerate primers to G-protein-coupled receptors. CMKRL2 (375 amino acids) is expressed in Raji and DAUDI cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |