FTL1 |
FTNA |
GGVSGVGDYKPIVVFGKSFNQFEAAEGAKG |
||
This peptide corresponds to Urocortin-3.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |