EC6.1.1.5 |
EC6.1.1.7 |
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
||
In the enzyme nomenclature catalogue, this is the designation for the Aminoacyl-tRNA synthetase and moonlighting protein lysyl-tRNA synthetase.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |