don't-eat-me signals |
dopamine amacrine cells |
SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW |
||
This protein is encoded by the Drosophila melanogaster mod(mdg4) [modifier of mdg4] gene (also: CG32491). mod(mdg4) is known also as E(var)3-93D.
Doom is one of at least 21 different known isoforms, all of which have specific functions in regulating the chromatin structure of different sets of genes throughout development (Büchner et al, 2000).
Overexpression of Doom causes cell death by apoptosis in insect cells. Doom interacts with the inhibitor of apoptosis proteins (see: IAP) of baculoviruses and this interaction prevents apoptosis caused by doom. Apoptosis caused by Doom is prevented also by
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |