Diapause hormone |
Diapause-specific peptide |
Bacillus cereus hemolysin 2 |
||
abbr. DSP. Called also Diapause-specific peptide. Diapausin (AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN) has been identified in hemolymph of diapausing individuals of the leaf beetle, Gastrophysa atrocyanea (Tanaka et al, 2003). Silencing of diapausin expression does not affect diapause onset or maintenance, but the peptide blocks fungal growth (Tanaka and Suzuki, 2005). Diapausins have been identified also in some other insects, and a family of 14 homologous peptides has been described in Manduca sexta (He Y et al, 2015). These peptides are thought to protect insects from fungal infection during diapause and other prolonged stationary stages.
Diapausin inhibits N-type voltage-dependent Ca2+ channels and acts on chromaffin cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |