DH |
Dh31 receptor |
CMTX4 |
||
[diuretic hormone 31] This Drosophila melanogaster protein (TVDFGLARGYSGTQEAKHRMGLAAANFAGGP), a 31-residue amidated calcitonin-like peptide that is the fly counterpart of CGRP [Calcitonin gene-related peptide], is encoded by gene CG13094.
Dh31 stimulates Malpighian tubules fluid secretion by activating the apical membrane V-ATPase via cyclic AMP of principal cells in the main secretory segment (Coast et al, 2001). The hormone is produced by an enteroendocrine cell type that regulates gut motility in the Drosophila melanogaster larval midgut. These enteroendocrine cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |