DNL2 |
DNLLAVRWFFAHSFDSQEALMVKMTKLRVVQYYGNFSRSA |
gas genes |
||
The N-acetylated DNLD-aldehyde, Ac-DNLD-CHO, is a potent and specific inhibitor of caspase-3 and is used, therefore, to probe an involvement of this caspase in cell death by apoptosis (Tanuma S et al, 2004; Yoshimori et al, 2007).
General note on chemical modifications: Practically all of the available caspase inhibitors, be they specific or pan-caspase inhibitors, come in chemically modified form. The introduction of an aldehyde group at the C-terminus of the short peptide sequences recognized by caspases
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |