DLG4 |
dlgr2 |
FFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
||
[Drosophila LGR1]. DLGR1 is a G-protein-coupled receptor encoded by Drosophila melanogaster gene CG7665. The receptor has been cloned by Hauser et al (1997) and shown to be structurally related to members of the thyroid-stimulating hormone, follicle-stimulating hormone, luteinizing hormone / choriogonadotropin receptor family from mammals. The DLGR1 gene contains 16 introns. Seven intron positions coincide with introns in the mammalian glycoprotein hormone receptor genes and have the same intron phasing, indicating that DLGR1 is evolutionarily related to the mammalian
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |