cytomegalovirus mitochondrial inhibitor of apoptosis |
cytomegalovirus OX2 protein |
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
||
[Cytomegalovirus UL146 protein] see: UL146.
For other relevant entries see also the Pathogenicity/Virulence Factors Dictionary section of this encyclopedia.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |