CSN1S2(182-189) |
CSN2 |
GVFTLIKGATQLIGKTLGKELGKTGLELMACKITNQC |
||
(approved gene symbol) (Alpha-s2-casein-like A; Casein-alpha-s2-like A); Gamma-casein, casein-gamma; abbr. also Csng. See: caseins.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |