CTTGPCCRQCKLKPAGTTCWRTSVSSHYCTGRSCECPSYPG |
CTX |
IL1 family member 4 |
||
This peptide, termed Pep42 by the authors, has been identified by phage display library screening, using whole-cell panning against human melanoma cell line Me6652/4 (Kim et al, 2006). The peptide is homologous to the plasminogen sequence Ser759-Phe778 (plasminogen(759-778)).
CTVALPGGYVRVC is a cell-penetrating peptide that shows preferential internalization into melanoma cell line Me6652/4 versus the reference cell line Me6652/56 in a receptor-mediated process. The receptor has been identified as glucose-regulated protein-78 (GRP78), and uptake of the peptide
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |