CD366 |
CD368 |
AGCIKNGGRCNASAGPPYCCSSYCFQIAGQSYGVCKNR |
||
In the nomenclature of CD antigens (see: Clark et al, 2016) this designation is used for CLEC4A [C-type lectin domain family 4 member A] (approved gene symbol. The protein is known also as
CLECSF6 [C-type lectin domain superfamily member 6]
DCIR [dendritic cell immunoreceptor]
DDB27 (C-type lectin DDB27), which is a databank synonym
LLIR [Lectin-like immunoreceptor].
For additional information on CD antigens see also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |