CCP module-containing protein 22 |
CCR2 |
LKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR |
||
[CCR1(+), CCR1(-), CCR1(high), CCR1(low)]
[CC-Chemokine receptor 1] Old designation: RANTES receptor, MIP-1-alpha receptor, LD78 receptor, CC-CKR1, HM145, YT4. In the nomenclature of CD antigens this protein has been given the designation CD191. The CCR1 receptor is known also as CMKBR1 [chemokine-beta receptor 1].
The human CCR1 gene has been mapped to chromosome 3p21 within a 285 kb region also containing the genes for CCR2 and CCR3.
This protein has been isolated as a cDNA that encodes a seven transmembrane-spanning
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |