C20orf183 |
C20orf185 |
GKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKP |
||
[chromosome 20 open reading frame 184]. The protein encoded by this open reading frame is identical with LPLUNC-2 [Long palate lung and nasal epithelium carcinoma-associated protein 2]. See: subentry under PLUNC.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |