COPE Media Kit


Cope Home
Previous entry:
BRCC45
Next entry:
BRCT domain
Random entry:
DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC
Search COPE:

BRC canopy cells

[bone remodeling compartment canopy cells] This cell type is located at the interface of the bone marrow and a bone remodeling site and forms a cell layer lining the bone marrow and forming a canopy over the whole remodeling surface (Hauge et al, 2001; Andersen et al, 2009; Jensen et al, 2012). The cells belong to the osteoblast lineage and may serve as progenitors of bone forming osteoblasts (Kristensen et al, 2014). Decreased bone formation is observed in disease conditions associated with BRC canopy cell deficiency Andersen et al, 2009; Jensen et al, 2012; Andersen et al, 2014).

For related information of interest see also: Cell types Dictionary, Cell lines in Cytokine Research, ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: April 2019



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=6533