BRCC45 |
BRCT domain |
DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC |
||
[bone remodeling compartment canopy cells] This cell type is located at the interface of the bone marrow and a bone remodeling site and forms a cell layer lining the bone marrow and forming a canopy over the whole remodeling surface (Hauge et al, 2001; Andersen et al, 2009; Jensen et al, 2012). The cells belong to the osteoblast lineage and may serve as progenitors of bone forming osteoblasts (Kristensen et al, 2014). Decreased bone formation is observed in disease conditions associated with BRC canopy cell deficiency Andersen et al, 2009; Jensen et al, 2012; Andersen et al, 2014).
For related information of interest see also: Cell types Dictionary, Cell lines in Cytokine Research,
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |