BP11 |
BP-34 |
AGECVQGRCPSGMCCSQFGYCGRGPKYCGR |
||
This peptide, KKLFKKILKKL, has been identified as a non-toxic cell-penetrating peptide from a set of antimicrobial peptides selected from a library of cecropin / melittin hybrids (Soler et al, 2014).
BP16 peptide is internalized by cells, including breast cancer cells and pancreas adenocarcinoma cells, mainly through a clathrin dependent endocytic mechanism and localizes in late endosomes. Coupling of BP16 to the anticancer drug chlorambucil, shows that BP16 peptide can be used as a drug delivery vector and improves drug delivery several-fold.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |