BAD |
BAD-alpha |
GLGSVFGRLARILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ |
||
BAD1 is the new designation of WI-1 (Wisconsin-1), a 120 kDa surface protein adhesin (Hogan et al, 1995) on Blastomyces dermatitidis yeasts, which are the agent of blastomycosis, a respiratory and disseminated mycosis of people and animals worldwide. BAD1 is an indispensible virulence factor, as demonstrated by the lack of virulence in strains with a targeted disruption of the BAD1 gene (Brandhorst et al, 1999).
The protein contains 30 highly conserved repeats of 24 amino acids arrayed in tandem in two noncontiguous regions of the protein. The repeat sequence is homologous to the Yersiniae adhesin invasin. The C terminus of WI-1 displays an EGF-like repeat, which may interact with components of the
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |