B7H |
B7-H2 |
VLSAADKNNVKGIFTKIAGHAEEYGAETLERMFTTYPPTKTY |
||
[B7 homolog-1] This protein, identified by Dong et al, 1999) as a protein that co-stimulates T-cell proliferation and IL10 secretion, has been termed also PDCD1L1 [PDCD1 Ligand 1] or PDL1 (programmed death-1 ligand 1). See: PDCD1 [programmed cell death-1], for which it serves as a ligand. In the nomenclature of CD antigen the designation is CD274.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |