B18 peptide |
B19R |
DYDWSLRGPPKCATYGQKCRTWSPPNCCWNLRCKAFRCRPR |
||
A gene encoded by vaccinia virus (B18R in the WR strain; B19R in other strains). The encoded glycoprotein (60-65 kDa) exists in a soluble and a membrane-bound form (Symons et al, 1995). The protein functions as a type 1 interferon (IFN) receptor with a broad species specificity and therefore behaves like a viroceptor. The B18R protein has high affinity for human IFN-alpha and also binds rabbit, bovine, rat, pig, and mouse IFN-alpha and IFN-beta (Colamoncini et al, 1995; Vancova et al, 1998).
Since the protein exists as a soluble extracellular and a cell surface protein it has the potential to block both
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |