Alpha-s2-casein(150-188) |
alpha-s2-casein(164-179) |
TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY |
||
This bioactive fragment of alpha-s2-casein (TKLTEEEKNRLNFLKKISQRYQKFΑLPQYLK) has been identified by Liu et al (2015) by virtual screening of an endogenous bovine milk peptide database for charge, amphipathy, and predicted secondary structure. The fragment shows antimicrobial activity against Bacillus subtilis and Escherichia coli and thus may have functions as a defense peptide.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |