Alpha-s1-casein(90-96) |
alpha-s1-casein(99-109) |
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
||
(casein-alpha-s1(99-105)) for this peptide derived from casein see: casein-derived iron-chelating peptides
See also cryptides for bioactive fragments of parent proteins. For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |