AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY |
Agrin-related protein-1 |
BAG1L |
||
approved gene symbol: AGRN. Agrin is a major large, highly negatively charged multidomain heparan sulfate proteoglycan (>500 kDa) of the extracellular matrix (ECM) with a calculated relative molecular mass of more than 200 kDa for the protein core (Tsen et al, 1995). The protein contains a number of structural domains, including regions of homology to laminin, Kazal protease inhibitors, and EGF repeats.
Agrin is synthesized and secreted by motoneurons at the axon terminal after anterograde axonal transport and binds to receptors present on muscle cells. In addition to motor neurons
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |