adrenocorticotropin cells |
adrenomedullin-1 |
YGGFMRSL |
||
abbr. AM or ADM (approved gene symbol). The abbreviation ADM1 [adrenomedullin-1] has been used also, following the identification of adrenomedullin-2.
Adrenomedullin is an alpha-amidated peptide (52 amino acids; YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY) isolated from extracts of human pheochromocytomas arising from adrenal medulla.
The human ADM gene consists of 4 exons
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |