Acrogranin |
Acrp30 |
ISDYSIRMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |
||
see: Some personal remarks for my views on acronyms and just for the fun of it have some of them in concentrated form: 26 kDa protein, 3-10C, 5637-derived factor, AGF, AGF-1, AGF-2, aHDGF, AIF, ANAP, APPIF, B151-TRF, BAF, BCAF, BCDF, BCDF-alpha, BCDF-epsilon, BCDF-gamma, BCDF-mu, BCGF-1, BCGF-2, BCGF-gamma, BCSF, BDF, BDGF-1.7, BDGF-A,
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |