ACAMP |
Ac-AMP-1 |
TNFRSF19 |
||
[Amaranthus caudatus antimicrobial peptides] Ac-AMP-1 [Amaranthus caudatus antimicrobial peptide-1] and Ac-AMP-2 [Amaranthus caudatus antimicrobial peptide-2] are two antimicrobial peptides isolated from seeds of amaranth (Amaranthus caudatus; (Love-lies-bleeding) (Inca-wheat)) (Brockaert et al, 1992). Ac-AMP-1 (VGECVRGRCPSGMCCSQFGYCGKGPKYCG) and Ac-AMP-2 (VGECVRGRCPSGMCCSQFGYCGKGPKYCGR), are almost identical. The amino acid sequences are highly homologous to the cysteine/glycine-rich domain occurring in many chitin-binding proteins. Both peptides reversibly bind to chitin. The gene encoding
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |