ALL1-fused gene from chromosome 3p21 |
Allatinhibin |
PCR |
||
ALL-38 (ALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES) is a processed form of the antimicrobial human protein CAP-18 (see: cathelicidins). The processing enzyme has been identified as the prostate-derived protease gastricsin. The antimicrobial activity of ALL-38 against a variety of microorganisms equals that of LL-37, another processed form of CAP-18.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |