30 kDa adipocyte complement-related protein |
3'-[1-[(phenylamino)-carbonyl]-3,4-tetrazolium]-bis(4-methoxy-6-nitro)benzene-sulfonic acid hydrate |
CLAGRLDKQCTCRRSQPSRRSGHEVGRPSPHCGPSRQCGCHMD |
||
This monoclonal antibody, which binds avidly to functionally active neutrophils and was used as a differentiation marker of neutrophils, recognizes an antigen of the same name, which has been identified as CD16 by Spiekermann et al (1996).
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |